Pay in 4 interest-free payments of $42.82 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
RKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Extra Notes: Western blot analysis of CHIP expression in 293 (A)
AF7544-100
Catalogue Numbers: DF7680-100
MICU2 Polyclonal Antibody-BS74781 Size:50µl RKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLMICU2 Polyclonal Antibody Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Sizes: 50l, 100l Catalogue Numbers: BS74781 50, BS74781 100 Swiss Prot: Q8IYU8 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB All Applications: WB,1: 500 1: 2000 Background: Key regulator of mitochondrial calcium uniporter (MCU required to limit calcium uptake by MCU when cytoplasmic calcium is low. MICU1 and MICU2 form a disulfide linked
US$ 110.00
US$ 69.00
US$ 19.90
US$ 19.90
US$ 39.90
US$ 35.90
US$ 29.90
US$ 44.90
US$ 179.95
US$ 55.00
US$ 55.00
US$ 24.90
US$ 63.00
US$ 55.00
US$ 150.00
US$ 44.90